PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004616.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 357aa    MW: 39836.6 Da    PI: 7.7917
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004616.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.56.6e-50291542128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                              +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg
  Itr_sc004616.1_g00001.1  29 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATG 113
                              79***************************.89***************8778899******************************** PP

                      NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               d+ +  ++++ +glkktLvfy+g+apkg +t+W+m+eyrl
  Itr_sc004616.1_g00001.1 114 ADRMIRGENSRSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 154
                              ***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-5628174IPR003441NAC domain
PROSITE profilePS5100555.62428175IPR003441NAC domain
PfamPF023654.7E-2530154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MSQQNQDERC QKNIEGEEAA DEHEHDMVMP GFRFHPTEEE LVEFYLRRKV EGKRFNVELI  60
TFLDLYRYDP WELPALAAIG EKEWFFYVPR DRKYRNGDRP NRVTTSGYWK ATGADRMIRG  120
ENSRSIGLKK TLVFYSGKAP KGIRTSWIMN EYRLPHHETE RLQKAEISLC RVYKRAGVDD  180
HHPSLPRSLQ TSRATATAAA SSSSSRGTAA IKKLHESSFS PYQVAEEKIS AETSGSSSTE  240
VGTSLGLSSY QSSYAAPIVP APPSPAFFSA SSSAVAAADD LHRLVNSQQQ ISLQHPQLFQ  300
SLSSPFPPPP MLQPLPPQNL ALPPGSLHAA AAFSDRLWDW SSMGDASRDY GAGNPFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-553017519165NO APICAL MERISTEM PROTEIN
1ut4_B4e-553017519165NO APICAL MERISTEM PROTEIN
1ut7_A4e-553017519165NO APICAL MERISTEM PROTEIN
1ut7_B4e-553017519165NO APICAL MERISTEM PROTEIN
3swm_A6e-553017522168NAC domain-containing protein 19
3swm_B6e-553017522168NAC domain-containing protein 19
3swm_C6e-553017522168NAC domain-containing protein 19
3swm_D6e-553017522168NAC domain-containing protein 19
3swp_A6e-553017522168NAC domain-containing protein 19
3swp_B6e-553017522168NAC domain-containing protein 19
3swp_C6e-553017522168NAC domain-containing protein 19
3swp_D6e-553017522168NAC domain-containing protein 19
4dul_A4e-553017519165NAC domain-containing protein 19
4dul_B4e-553017519165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012078844.11e-145PREDICTED: NAC domain-containing protein 55-like
SwissprotQ9FIW53e-62NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLA0A068TNX51e-149A0A068TNX5_COFCA; Uncharacterized protein
STRINGVIT_12s0035g02020.t011e-132(Vitis vinifera)
STRINGGLYMA17G00650.21e-132(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38882446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-110NAC domain containing protein 35